Op werkdagen voor 23:00 besteld, morgen in huis Gratis verzending vanaf €20
-
Inloggen
-- Inloggen
  • accountoverzicht
  • bestellingen
  • facturen betalen
  • downloadcentrum
  • gegevens
  • financieel
  • inloggen
  • uitloggen

Uw winkelwagen

Naar winkelwagen Verder winkelen
Boek niet gevonden? Wij gaan voor u op zoek!
Vul onderstaand formulier zo volledig mogelijk in, dan gaan wij voor u op zoek.
Vul onderstaand formulier zo volledig mogelijk in.
Helpfunctie Abonnementen
Abonnementencatalogus
  • Algemeen
    • Uw abonnementen
    • Verlengen / opzeggen
    • Openstaande claims
    • Bibliografische wijzigingen
    • Abonnementshouders
    • Afleveradressen
    • Referenties
    • Notities
  • Rubrieken
    • Computer en informatica
    • Economie
    • Juridisch
    • Kunst en cultuur
    • Literatuur en romans
    • Management
    • Mens en maatschappij
    • Psychologie
    • Religie
    • Sport, hobby, lifestyle
    • Wetenschap en techniek
    • Woordenboeken en taal
Boekseries
Boekseriecatalogus
  • Algemeen
    • Uw serieabonnementen
    • Geadresseerden
    • Abonnementshouders
    • Afleveradressen
    • Referenties
    • Notities
  • Aanbevolen per ministerie
    • Algemene Zaken
    • Binnenlandse Zaken en Koninkrijksrelaties
    • Buitenlandse Zaken
    • Defensie
    • Economische Zaken en Klimaat
    • Financiën
    • Infrastructuur en Waterstaat
    • Justitie en Veiligheid
    • Landbouw, Natuur en Voedselkwaliteit
    • Onderwijs, Cultuur en Wetenschap
    • Nationale Politie
    • Sociale Zaken en Werkgelegenheid
    • Volksgezondheid, Welzijn en Sport
Productaanvraag Boeken
Boekencatalogus
  • Cadeauboeken
  • Computer & Informatica
  • Economie
  • Filosofie
  • Flora en fauna
  • Geneeskunde
  • Geschiedenis
  • Gezondheid
  • Jeugd
  • Koken en eten
  • Kunst en cultuur
  • Literatuur en romans
  • Management
  • Mens en maatschappij
  • Naslagwerken
  • Non-fictie informatief/professioneel
  • Paramedisch
  • Psychologie
  • Reizen
  • Religie
  • Schoolboeken
  • Spiritualiteit
  • Sport, hobby, lifestyle
  • Thrillers en spanning
  • Wetenschap en techniek
  • Woordenboeken en taal
Contact
010-4091943
Klantenservice
Mijn account
Mijn bestellingen
0318-508539
Boeken IT-management / ICT The Cherry Model
The Cherry Model
The Cherry Model
The Cherry Model
The Cherry Model
Anneke Keller

Both TomTom and Coolblue grew tremendously while Anneke was heading the IT department. At Jumbo, she found and lead the Jumbo Tech Campus which, made their online proposition successful and corona-proof. Lately she was CTO of the e-commerce company Wehkamp. 

In 2022, she received a top-3 nomination as "CIO of the year" from ICT Media.

Meer over de auteurs
The Cherry Model - Four seasons of innovating IT organisations Anneke Keller 22 augustus 2023 In The Cherry Model nemen Anneke Keller - in het verleden CTO en IT leider bij Wehkamp, Jumbo, Coolblue, TomTom en KPN en Tim Meeuwissen - Lead Technology and Architecture bij Jumbo Supermarkten de lezer mee in de vier seizoenen van innovatie in IT organisatie. In deze preview vertelt Keller over het boek. Lees het volledige artikel
Anneke Keller, Tim Meeuwissen

The Cherry Model

Four seasons of innovating IT organisations

Specificaties
Paperback, 156 blz. | Engels
KeKe46 | 1e druk, 2023
ISBN13: 9789083332888
Rubricering
Hoofdrubriek : Management
KeKe46 1e druk, 2023 9789083332888
€ 29,95
In winkelwagen
Op voorraad
Vandaag voor 23:00 besteld, vrijdag in huis
Gratis verzonden
Past door de brievenbus

Samenvatting

IT is often evaluated based on hard skills. The resilience of architecture, the amount of coding languages you master, how many years of experience the tech department has. These aspects form the pit of the cherry. They are important, but none of them bring innovation. Soft skills do. Innovation grows when people learn from each other, work together and challenge each other. Soft skills are the cherry’s nutritious, sweet flesh that brings all the birds to the yard.

Anneke Keller created the Cherry Model based on 25 years of experience as innovation leader. Every tech organisation – entire companies even – have a rhythm for growth and change. After a summery phase of seemingly endless innovation inevitably follows a harsh season of stagnation and cutbacks. How can you as a leader predict and recognise these different phases and use them to support and create an innovative organisation?

In 'The Cherry Model' Anneke and her former colleague and technology guru Tim Meeuwissen guide you through the seasons of innovation sharing their stories, lively anecdotes and helpful tips and tricks.

Trefwoorden

it-organisatieinnovatieleiderschapverandermanagementstabilisatiecrisismanagementprocesverbeteringtechnologisch leiderschapcherry modeldigital transformationfeedback loopskwaliteitsmanagementorganisatieontwikkelingteamontwikkelingtechnische schuldroot cause analysiscrisisleidinggevenveerkrachtpdca-cyclusbrandbestrijdingpostmortem analyseprioriteringsoft skillsbrandbestrijdingpostmortem analyseprioriteringsoft skills
it-organisatieinnovatieleiderschapverandermanagementstabilisatietechnologisch leiderschapcrisismanagementcherry modelprocesverbeteringorganisatieontwikkelingdigital transformationfeedback loopskwaliteitsmanagementteamontwikkelingveerkrachtcrisispdca-cyclusleidinggeventechnische schuldroot cause analysisprioriteringpostmortem analysesoft skillsbrandbestrijdingprioriteringpostmortem analysesoft skillsbrandbestrijding

Specificaties

ISBN13:9789083332888
Taal:Engels
Bindwijze:paperback
Aantal pagina's:156
Uitgever:KeKe46
Druk:1
Verschijningsdatum:24-8-2023
Hoofdrubriek:IT-management / ICT

Over Anneke Keller

Anneke has been working in the technology industry for 25 years. She had the opportunity to lead IT teams through big transformations. During the first 10 years of her career the telecommunications company KPN transformed to a professional service organisation entering new markets like the mobile and internet market. Both TomTom and Coolblue grew tremendously while Anneke was heading their IT departments. At Jumbo, she was allowed to found and lead the Jumbo Tech Campus which, among other things, made their online proposition successful and future-proof. Her last employer is e-commerce company Wehkamp. 

Andere boeken door Anneke Keller

Bekijk alle boeken

Over Tim Meeuwissen

Tim is currently employed at Jumbo, the second biggest supermarket chain in the Netherlands. It is his job as a lead pathfinder to help create optimum value out of technology and the development time. As chairman of the Tech Board, he is in charge of deciding which software enters the complex landscape. Especially when software is destined to be built in-house, Tim’s years of experience ensures that the right questions are being asked, and everybody is aligned and headed in the right direction. After all, he and his team are responsible for the future of technology at Jumbo. Jumbo is a well-known brand in the Netherlands. Their digital presence has fortified greatly since 2018, as did the teams at Jumbo Tech Campus. It is Tim’s personal target to speed up the effects of scaling according to Conway’s Law. He does this by being a partner for business as well as Development and Management, guiding them towards a service oriented architecture, securing its longevity by practising domain driven design along the way. Because of his extensive experience in business as well as technology, Tim is able to deeply connect with both areas. He was owner of an ERP software writing company for about 15 years, and has created logistic software for large retailers and worked on several e-commerce and advertising solutions. Before coming to Jumbo, Tim worked at Spil Games to help them transition multiple large game publishing platforms from on-premise to a cloud platform as software architect. He’s also been chairman of the works council there, guarding the balance between staff and corporate strategic movement. Tim is passionate about under- standing how things work. When you see him at home, you’ll probably find him welding, sawing, creating something out of thin air. He has four sheep, a dog, chickens and is a beekeeper, while tinkering with IoT, aquaponics or anything that sparks his mind. He doesn’t like to watch sports unless they are extreme and practised by himself. For Tim, understanding nature brings the perfect counterbalance to the abstract thinking at work.

Andere boeken door Tim Meeuwissen

Bekijk alle boeken

Inhoudsopgave

Introduction 11

Winter 27
Spring 49
Summer 87
Autumn 115
Epilogue 137
In conclusion 143

About the authors 154
Anneke Keller 154
Tim Meeuwissen 155

Anderen die dit boek kochten, kochten ook

  • Effective Java
    Joshua Bloch
    Effective Java
    € 59,74
  • DNA zoekmachine
    Lex Meulenbroek
    DNA zoekmachine
    € 34,95
  • Statistiek voor Dummies
    Deborah Rumsey
    Statistiek voor Dummies
    € 34,99
  • Bitcoins voor Dummies
    Michiel Kelder
    Bitcoins voor Dummies
    € 19,99
  • Exam Ref AZ-500 Microsoft Azure Security Technologies
    Yuri Diogenes
    Exam Ref AZ-500 Microsoft Azure Security Technologies
    € 50,14
  • Refactoring
    Martin Fowler
    Refactoring
    € 64,54
€ 29,95
Morgen in huis
Gratis verzonden

Rubrieken

Uw cookie-instellingen
Deze website maakt gebruik van verschillende soorten cookies. Sommige cookies worden geplaatst door diensten van derden die op onze pagina's worden weergegeven. Om deze externe content te kunnen tonen is nodig dat u toestemming geeft voor het zetten van persoonlijke en marketingcookies. U kunt uw toestemming op elk moment wijzigen of intrekken. In onze cookieverklaring vindt u meer informatie.

Functionele cookies
Deze zijn noodzakelijk voor de werking van de website, zonder deze cookies kan de website niet naar behoren werken.

Persoonlijke en marketingcookies
Wij gebruiken cookies voor statistieken om bij te houden en rapportages te krijgen over hoe bezoekers de website gebruiken. Zo kunnen wij onze website verbeteren. Marketingcookies worden gebruikt om bezoekers te volgen wanneer ze verschillende websites bezoeken. Hun doel is advertenties weergeven die zijn toegesneden op en relevant zijn voor de individuele gebruiker.
Op werkdagen voor 23:00 besteld, morgen in huis Gratis verzending vanaf €20

Klantenservice

Contact Voorwaarden

Bezoekadres

Kernreactorstraat 9b
3903 LG  Veenendaal

Postadres

Postbus 623
3900 AP  Veenendaal
DE OPLOSSING VOOR ZORGELOOS EN EFFICIËNT ABONNEMENTENBEHEER
Algemene voorwaarden Privacy Cookies Service & Contact
© 2026 PS Media

    Personen

      Trefwoorden

        The Cherry Model

        The Cherry Model
        Anneke Keller , Tim Meeuwissen
        /
        loader
        Recensiebeleid
        AI-book

        Wat is een AI-book?

        Een AI-book is niet een boek dat geschreven is door AI maar een boek dat verrijkt is met AI. Het maakt de inhoud van een boek interactief via WhatsApp, zodat je ermee kunt chatten. Zie het als een razend slimme assistent die het boek perfect begrijpt en er alles uit onthouden heeft. Jij kunt deze assistent alles vragen. Vraag bijvoorbeeld hoe je iets kunt toepassen op jouw persoonlijke situatie, om een korte samenvatting, of wat de belangrijkste inzichten zijn. AI-books zijn alleen te gebruiken via WhatsApp, je hoeft er geen aparte app voor te installeren.
        Meer informatie over AI-books

        ?

        Geef uw beoordeling

        The Cherry Model

        Verwijder uw beoordeling