Op werkdagen voor 23:00 besteld, morgen in huis Gratis verzending vanaf €20
-
Inloggen
-- Inloggen
  • accountoverzicht
  • bestellingen
  • facturen betalen
  • downloadcentrum
  • gegevens
  • financieel
  • inloggen
  • uitloggen

Uw winkelwagen

Naar winkelwagen Verder winkelen
Boek niet gevonden? Wij gaan voor u op zoek!
Vul onderstaand formulier zo volledig mogelijk in, dan gaan wij voor u op zoek.
Vul onderstaand formulier zo volledig mogelijk in.
Helpfunctie Abonnementen
Abonnementencatalogus
  • Algemeen
    • Uw abonnementen
    • Verlengen / opzeggen
    • Openstaande claims
    • Bibliografische wijzigingen
    • Abonnementshouders
    • Afleveradressen
    • Referenties
    • Notities
  • Rubrieken
    • Computer en informatica
    • Economie
    • Juridisch
    • Kunst en cultuur
    • Literatuur en romans
    • Management
    • Mens en maatschappij
    • Psychologie
    • Religie
    • Sport, hobby, lifestyle
    • Wetenschap en techniek
    • Woordenboeken en taal
Boekseries
Boekseriecatalogus
  • Algemeen
    • Uw serieabonnementen
    • Geadresseerden
    • Abonnementshouders
    • Afleveradressen
    • Referenties
    • Notities
  • Aanbevolen per ministerie
    • Algemene Zaken
    • Binnenlandse Zaken en Koninkrijksrelaties
    • Buitenlandse Zaken
    • Defensie
    • Economische Zaken en Klimaat
    • Financiën
    • Infrastructuur en Waterstaat
    • Justitie en Veiligheid
    • Landbouw, Natuur en Voedselkwaliteit
    • Onderwijs, Cultuur en Wetenschap
    • Nationale Politie
    • Sociale Zaken en Werkgelegenheid
    • Volksgezondheid, Welzijn en Sport
Productaanvraag Boeken
Boekencatalogus
  • Cadeauboeken
  • Computer & Informatica
  • Economie
  • Filosofie
  • Flora en fauna
  • Geneeskunde
  • Geschiedenis
  • Gezondheid
  • Jeugd
  • Koken en eten
  • Kunst en cultuur
  • Literatuur en romans
  • Management
  • Mens en maatschappij
  • Naslagwerken
  • Non-fictie informatief/professioneel
  • Paramedisch
  • Psychologie
  • Reizen
  • Religie
  • Schoolboeken
  • Spiritualiteit
  • Sport, hobby, lifestyle
  • Thrillers en spanning
  • Wetenschap en techniek
  • Woordenboeken en taal
Contact
010-4091943
Klantenservice
Mijn account
Mijn bestellingen
0318-508539
Boeken IT-management / ICT The Official (ISC)2 SSCP CBK Reference
The Official (ISC)2 SSCP CBK Reference
The Official (ISC)2 SSCP CBK Reference
The Official (ISC)2 SSCP CBK Reference
The Official (ISC)2 SSCP CBK Reference
Mike Wills

Mike Wills, SSCP, CISSP, Assistant Professor and Program Chair of Applied Information Technologies in the College of Business at Embry-Riddle Aeronautical University's Worldwide Campus.

Meer over Mike Wills
Mike Wills

The Official (ISC)2 SSCP CBK Reference

Specificaties
Gebonden, 832 blz. | Engels
Sybex | 6e druk, 2022
ISBN13: 9781119874867
Rubricering
Sybex 6e druk, 2022 9781119874867
€ 90,40
In winkelwagen
Nu besteld, woensdag in huis
Gratis verzonden

Samenvatting

The only official body of knowledge for SSCP—(ISC)2’s popular credential for hands-on security professionals—fully revised and updated 2021 SSCP Exam Outline.
Systems Security Certified Practitioner (SSCP) is an elite, hands-on cybersecurity certification that validates the technical skills to implement, monitor, and administer IT infrastructure using information security policies and procedures. SSCP certification—fully compliant with U.S. Department of Defense Directive 8140 and 8570 requirements—is valued throughout the IT security industry. The Official (ISC)2 SSCP CBK Reference is the only official Common Body of Knowledge (CBK) available for SSCP-level practitioners, exclusively from (ISC)2, the global leader in cybersecurity certification and training.

This authoritative volume contains essential knowledge practitioners require on a regular basis. Accurate, up-to-date chapters provide in-depth coverage of the seven SSCP domains: Security Operations and Administration; Access Controls; Risk Identification, Monitoring and Analysis; Incident Response and Recovery; Cryptography; Network and Communications Security; and Systems and Application Security.

Designed to serve as a reference for information security professionals throughout their careers, this indispensable (ISC)2 guide:

Provides comprehensive coverage of the latest domains and objectives of the SSCP
Helps better secure critical assets in their organizations
Serves as a complement to the SSCP Study Guide for certification candidates
The Official (ISC)2 SSCP CBK Reference is an essential resource for SSCP-level professionals, SSCP candidates and other practitioners involved in cybersecurity.

Trefwoorden

informatiebeveiligingcyberbeveiligingsscpcertificeringincidentresponscryptografiesecurity operationssysteembeheerapplicatiebeveiligingnetwerkbeveiligingrisicomanagementtoegangscontroleit-beveiligingdisaster recoveryrisicoanalysebeveiligingsbeleidencryptiecomplianceit-infrastructuurauthenticatieautorisatiemonitoringauthenticatieautorisatiemonitoring
informatiebeveiligingcyberbeveiligingsscpcertificeringsysteembeheerincidentresponsnetwerkbeveiligingtoegangscontrolerisicomanagementcryptografiesecurity operationsapplicatiebeveiligingit-beveiligingdisaster recoveryrisicoanalyseit-infrastructuurencryptiecompliancebeveiligingsbeleidmonitoringautorisatieauthenticatiemonitoringautorisatieauthenticatie

Specificaties

ISBN13:9781119874867
Taal:Engels
Bindwijze:gebonden
Aantal pagina's:832
Uitgever:Sybex
Druk:6
Verschijningsdatum:13-6-2022
Hoofdrubriek:IT-management / ICT

Over Mike Wills

Mike Wills, SSCP, CISSP, Assistant Professor and Program Chair of Applied Information Technologies in the College of Business at Embry-Riddle Aeronautical University's Worldwide Campus. Mike has been a pioneer in ethical hacking since his days as a phone phreak. His many years of cutting-edge experience in secure systems design, development, and operation have enriched the dozens of courses he's built and taught. He created ERAU's Master of Science in Information Security and Assurance degree program and leads the university's teaching and courseware development for the Microsoft Software & Systems Academy at ERAU's 13 US teaching sites.

Andere boeken door Mike Wills

Bekijk alle boeken

Inhoudsopgave

Foreword xxiii
Introduction xxv

Chapter 1: Security Operations and Administration 1
Chapter 2: Access Controls 83
Chapter 3: Risk Identification, Monitoring, And Analysis 147
Chapter 4: Incident Response and Recovery 247
Chapter 5: Cryptography 335
Chapter 6: Network and Communications Security 467
Chapter 7: Systems and Application Security 649

Appendix: Cross-Domain Challenges 731

Index 769

Anderen die dit boek kochten, kochten ook

  • (ISC)2 SSCP Study Guide and SSCP Practice Test Kit
    Mike Wills
    (ISC)2 SSCP Study Guide and SSCP Practice Test Kit
    € 90,40
  • Digitale Soevereiniteit
    Michiel de van der Schueren
    Digitale Soevereiniteit
    € 39,50
  • Werk hand in hand met AI
    Kim Pot
    Werk hand in hand met AI
    € 24,50
  • The NIS2 Navigator’s Handbook
    Michiel Benda
    The NIS2 Navigator’s Handbook
    € 59,90
  • De ISM-methode versie 5
    Wim Hoving
    De ISM-methode versie 5
    € 49,00
  • GEO - Zichtbaar zijn in de antwoorden van AI
    Jarik Oosting
    GEO - Zichtbaar zijn in de antwoorden van AI
    € 17,99
€ 90,40
Woensdag in huis
Gratis verzonden

Rubrieken

Uw cookie-instellingen
Deze website maakt gebruik van verschillende soorten cookies. Sommige cookies worden geplaatst door diensten van derden die op onze pagina's worden weergegeven. Om deze externe content te kunnen tonen is nodig dat u toestemming geeft voor het zetten van persoonlijke en marketingcookies. U kunt uw toestemming op elk moment wijzigen of intrekken. In onze cookieverklaring vindt u meer informatie.

Functionele cookies
Deze zijn noodzakelijk voor de werking van de website, zonder deze cookies kan de website niet naar behoren werken.

Persoonlijke en marketingcookies
Wij gebruiken cookies voor statistieken om bij te houden en rapportages te krijgen over hoe bezoekers de website gebruiken. Zo kunnen wij onze website verbeteren. Marketingcookies worden gebruikt om bezoekers te volgen wanneer ze verschillende websites bezoeken. Hun doel is advertenties weergeven die zijn toegesneden op en relevant zijn voor de individuele gebruiker.
Op werkdagen voor 23:00 besteld, morgen in huis Gratis verzending vanaf €20

Klantenservice

Contact Voorwaarden

Bezoekadres

Kernreactorstraat 9b
3903 LG  Veenendaal

Postadres

Postbus 623
3900 AP  Veenendaal
DE OPLOSSING VOOR ZORGELOOS EN EFFICIËNT ABONNEMENTENBEHEER
Algemene voorwaarden Privacy Cookies Service & Contact
© 2026 PS Media

    Personen

      Trefwoorden

        The Official (ISC)2 SSCP CBK Reference

        The Official (ISC)2 SSCP CBK Reference
        Mike Wills
        /
        loader
        Recensiebeleid
        AI-book

        Wat is een AI-book?

        Een AI-book is niet een boek dat geschreven is door AI maar een boek dat verrijkt is met AI. Het maakt de inhoud van een boek interactief via WhatsApp, zodat je ermee kunt chatten. Zie het als een razend slimme assistent die het boek perfect begrijpt en er alles uit onthouden heeft. Jij kunt deze assistent alles vragen. Vraag bijvoorbeeld hoe je iets kunt toepassen op jouw persoonlijke situatie, om een korte samenvatting, of wat de belangrijkste inzichten zijn. AI-books zijn alleen te gebruiken via WhatsApp, je hoeft er geen aparte app voor te installeren.
        Meer informatie over AI-books

        ?

        Geef uw beoordeling

        The Official (ISC)2 SSCP CBK Reference

        Verwijder uw beoordeling